DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG7514

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:298 Identity:88/298 - (29%)
Similarity:140/298 - (46%) Gaps:35/298 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108
            ||...:|..:......||||.|||:||..         :..:|:........:.:.||.|.|:.|
  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQISA---------TTGEYKSSFDCLLKVFKNEGILALYNG 71

  Fly   109 VTPALYRHVVYSGVRICSY----DLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVK 169
            ::..|.|...|:..|:..|    |..||:|....|    |..|...|:.|||......:||::..
  Fly    72 LSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPT----VLASMGMGILAGAFGAMFGNPAEVAL 132

  Fly   170 VQIQMEGRRRLMGEPP--RVHSAG--HAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDT 230
            :::..:.|.     ||  |.:..|  :||.:||:..|:..||||.:|.|.||.:||:..|.:|..
  Fly   133 IRMMSDNRL-----PPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQ 192

  Fly   231 IKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLR 295
            :|.......   ...::|:.|::.:|.:..|...|.|:.||||..|.|.|      |:|::|.|.
  Fly   193 LKAAFSEYF---SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE------YKGTMDVLM 248

  Fly   296 QTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333
            :....||..:|:|||.|...|:.|.::..::..||:.|
  Fly   249 KVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 88/298 (30%)
Mito_carr 39..138 CDD:278578 27/97 (28%)
Mito_carr 142..239 CDD:278578 31/100 (31%)
Mito_carr 248..336 CDD:278578 29/86 (34%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 88/298 (30%)
Mito_carr 19..90 CDD:278578 20/79 (25%)
Mito_carr 104..201 CDD:278578 32/105 (30%)
Mito_carr 207..284 CDD:278578 27/82 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441676
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.