DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and PMP34

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:340 Identity:71/340 - (20%)
Similarity:134/340 - (39%) Gaps:58/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 APSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELAT-YPLDLTKTRLQIQGEGAAHSAGKSNM 84
            |||.....|....|.:|        ||..|.....::| ||||..::|||::..|...|.     
  Fly     3 APSKLSQVLSYQNFVHA--------VSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRST----- 54

  Fly    85 QYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSAL 149
              |.::..   |...||...|::|:.|.|....:.:.|...::..::...:..........|..|
  Fly    55 --RQVIKE---IVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLL 114

  Fly   150 CGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGH------AFRQIVQRGGIKGLWK 208
            .|..||.:.....:|..:|..:::|   |.:.|....|:.  |      ..:.:.::.||.|||.
  Fly   115 LGSIAGIINVLTTTPFWVVNTRLRM---RNVAGTSDEVNK--HYKNLLEGLKYVAEKEGIAGLWS 174

  Fly   209 GSIPN---VQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAI-------MG 263
            |:||:   |...||    ....|:.:|..||.       .|...:.|:...|:.||       :.
  Fly   175 GTIPSLMLVSNPAL----QFMMYEMLKRNIMR-------FTGGEMGSLSFFFIGAIAKAFATVLT 228

  Fly   264 TPADVVKTRIMNQPTDENGRGLLYRGS-------VDCLRQTVSKEGFVALYKGFLPCWIRMAPWS 321
            .|..:|:|:..::..:.:.:.....||       ::.:...:..:|...|::|.....::....:
  Fly   229 YPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTA 293

  Fly   322 LTFWLSFEQIRKMIG 336
            ...::::|:|...:|
  Fly   294 ALMFMAYEKIAGTVG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 64/319 (20%)
Mito_carr 39..138 CDD:278578 22/99 (22%)
Mito_carr 142..239 CDD:278578 27/105 (26%)
Mito_carr 248..336 CDD:278578 14/101 (14%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/98 (24%)
Mito_carr 105..202 CDD:278578 26/105 (25%)
Mito_carr 214..303 CDD:278578 12/88 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.