DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and Shawn

DIOPT Version :10

Sequence 1:NP_573246.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:64 Identity:18/64 - (28%)
Similarity:33/64 - (51%) Gaps:8/64 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 ILVDTVWALSYLTDGGNEQIQLVIDSGVVPKLI-PLLSHVEV-KVQTAALRAVGNIVTGSDDQT 316
            :|||....::.|      ||.:.|.|..||.|| |:|:.:.: :::|...|....:.:.|.:|:
  Fly   189 VLVDCFSCVTSL------QIHISICSRFVPSLIYPILTTILILQLRTIKKRKANLLKSTSSNQS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_573246.1 Mito_carr 39..138 CDD:395101
Mito_carr 142..239 CDD:395101
Mito_carr 248..336 CDD:395101 18/64 (28%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:395101
Mito_carr 178..265 CDD:395101 18/64 (28%)
Mito_carr 268..371 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.