DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and sea

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:306 Identity:74/306 - (24%)
Similarity:125/306 - (40%) Gaps:56/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 APSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQ 85
            |..||:..|:.:            :...:...|....|||.:..||:||:..:|||       .:
  Fly    26 AADSGQVGLKGI------------VAGGITGGIEICITYPTEYVKTQLQLDEKGAA-------KK 71

  Fly    86 YRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALC 150
            |.|:.........|.|.|.|::|::..:|..:..|..|..:::.::.....:..|.....| .||
  Fly    72 YNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDSRGQLSNSGK-LLC 135

  Fly   151 GVTAGAVAQWLA-SPADLVKVQI---QMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSI 211
            |:.||.....:| :|.:.:||:.   |..|.       |:.....|...||::..||.|::||..
  Fly   136 GLGAGVCEAIVAVTPMETIKVKFINDQRSGN-------PKFRGFAHGVGQIIKSEGISGIYKGLT 193

  Fly   212 PNVQRAALVNLGDLTTYDTIKHLIMNRLQ---MPDCHT-------VHVLASVCAGFVAAIMGTPA 266
            |.:.:..        :...|:..::..|:   ..|.||       |.|..:: ||..:....||.
  Fly   194 PTILKQG--------SNQAIRFFVLESLKDLYKGDDHTKPVPKLVVGVFGAI-AGAASVFGNTPL 249

  Fly   267 DVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLP 312
            ||||||:......:      |:.:..|..:.:..||..|.|||.:|
  Fly   250 DVVKTRMQGLEASK------YKNTAHCAVEILKNEGPAAFYKGTVP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 70/288 (24%)
Mito_carr 39..138 CDD:278578 21/98 (21%)
Mito_carr 142..239 CDD:278578 23/100 (23%)
Mito_carr 248..336 CDD:278578 20/65 (31%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 71/298 (24%)
Mito_carr 34..117 CDD:278578 22/101 (22%)
Mito_carr 125..220 CDD:278578 25/110 (23%)
Mito_carr 235..314 CDD:278578 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.