DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG18324

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:294 Identity:91/294 - (30%)
Similarity:149/294 - (50%) Gaps:12/294 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108
            :::...||..|.:.|.|:|:.|||:|:|||.||.  |.....||.:......|...:|.|.|.:|
  Fly     6 FVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAAR--GTYVKPYRHLPQAMLQIVLNDGLLALEKG 68

  Fly   109 VTPALYRHVVYSGVRICSY-DLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQI 172
            :.|||....|.:.||:..| :.:...:.||...::..::....|...|....:.|||..::|.|.
  Fly    69 LAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQ 133

  Fly   173 QMEGRRRL-MGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIM 236
            ..:..:.: :|...:..|...|...|.:..||.|.|:.::|::.|..:.:...:.|:...|.|:.
  Fly   134 HAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLK 198

  Fly   237 NRLQMPDCHTVHVLASVCAGF----VAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQT 297
            ::..:    |..||.|.|||.    :.|:..:|.||:.||:.|||.||.||||:|:|.|||..:.
  Fly   199 DKGWI----THPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKI 259

  Fly   298 VSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQI 331
            ...||...:||||.|.:.|.||.:...::.||::
  Fly   260 WRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 91/294 (31%)
Mito_carr 39..138 CDD:278578 31/94 (33%)
Mito_carr 142..239 CDD:278578 20/97 (21%)
Mito_carr 248..336 CDD:278578 38/88 (43%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 29/82 (35%)
PTZ00169 5..293 CDD:240302 91/292 (31%)
Mito_carr 101..201 CDD:278578 20/99 (20%)
Mito_carr 204..296 CDD:278578 39/90 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.