DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and Slc25a30

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:298 Identity:114/298 - (38%)
Similarity:178/298 - (59%) Gaps:24/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108
            ::...:|:..||..|:|:|||||||||||:  .:.|....::||||:.....|.||||...|:.|
  Rat     9 FVYGGLASITAECGTFPIDLTKTRLQIQGQ--TNDAKFREIRYRGMLHALMRIGREEGLRALYSG 71

  Fly   109 VTPALYRHVVYSGVRICSYDLMRK---EFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKV 170
            :.||:.|...|..::|.:|..:::   |..::.|..:.|    :||:.:|.::..:|:|.|::|:
  Rat    72 IAPAMLRQASYGTIKIGTYQSLKRLAVERPEDETLLINV----VCGILSGVISSAIANPTDVLKI 132

  Fly   171 QIQMEG---RRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYD-TI 231
            ::|.:.   :..::|.          |..|.|:.|.:|||||.....||||:|...:|..|| |.
  Rat   133 RMQAQNSAVQGGMIGN----------FISIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITK 187

  Fly   232 KHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQ 296
            ||||::.| |.|..:.|.|:|...|.|.|:...|.|||:||:|||....:||...|:|::|||.|
  Rat   188 KHLILSGL-MGDTVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCSGYKGTLDCLLQ 251

  Fly   297 TVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKM 334
            |...|||.||||||.|.|:|:.||::.|:|::||::|:
  Rat   252 TWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 114/298 (38%)
Mito_carr 39..138 CDD:278578 35/96 (36%)
Mito_carr 142..239 CDD:278578 32/100 (32%)
Mito_carr 248..336 CDD:278578 43/87 (49%)
Slc25a30NP_001013205.1 Solcar 1 7..96 34/88 (39%)
PTZ00169 9..289 CDD:240302 113/296 (38%)
Solcar 2 104..189 29/98 (30%)
Solcar 3 198..289 43/90 (48%)
Mito_carr 199..289 CDD:395101 42/89 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.