DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG4995

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:191 Identity:52/191 - (27%)
Similarity:84/191 - (43%) Gaps:11/191 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPN 213
            :.|:..||....:..|.|.|||.:|.:..|.     |:.....|.||.||||....||::|....
  Fly    45 VAGLLGGAAGVLVGHPFDTVKVHLQTDDPRN-----PKYKGTFHCFRTIVQRDKFIGLYRGISSP 104

  Fly   214 VQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPT 278
            :....|||......|..::.|..:    |:..|.|..|...||.....:..|.::.|||:  |.:
  Fly   105 MGGIGLVNAIVFGVYGNVQRLSND----PNSLTSHFFAGSIAGVAQGFVCAPMELAKTRL--QLS 163

  Fly   279 DENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIGASG 339
            .:...|:.:.|.:.||:..|..||....:||.....:|..|...::::|||.:.:.:...|
  Fly   164 TQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVETPG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 51/185 (28%)
Mito_carr 39..138 CDD:278578
Mito_carr 142..239 CDD:278578 26/89 (29%)
Mito_carr 248..336 CDD:278578 23/87 (26%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 25/84 (30%)
PTZ00169 41..295 CDD:240302 52/191 (27%)
Mito_carr 128..218 CDD:278578 25/95 (26%)
Mito_carr 221..304 CDD:278578 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.