DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG9582

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:294 Identity:75/294 - (25%)
Similarity:134/294 - (45%) Gaps:25/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108
            ::...::..|..:..:|||:.|||:||||   ||..| ..:.|...:.....|.|.||...||:|
  Fly    17 FLAGGLSGFIEIICFHPLDVVKTRMQIQG---AHPFG-GEVVYTCPLDAIVKIYRYEGLSSLWKG 77

  Fly   109 VTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQ 173
            :.|.:.......|.:...|:.::..|.....|..|: ..|:.|..|..:..:|.:|.::||:..|
  Fly    78 IVPPICVETPKRGGKFLMYESLKPYFQFGAPQPTPL-THAMSGSMAAILESFLVNPFEVVKITQQ 141

  Fly   174 MEGRRRLMGEPPRVHSAGHAFRQIVQRG--GIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIM 236
            ....:||        ......:.|::..  |||||::|....|.|.|:.:.|....|:.:|.::.
  Fly   142 AHRGKRL--------KTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVP 198

  Fly   237 NRLQMPDCHTVHVLASV----CAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQT 297
            :    |:..|.::|..|    .|..:|.:|....|:.|.||.. |....|. :.|:.::..::.|
  Fly   199 S----PEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQG-PQPVKGE-VKYQWTISTIKST 257

  Fly   298 VSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQI 331
            ..:|||.:|:||.....:|:.|......:::|.:
  Fly   258 FKEEGFRSLFKGLGAMILRVGPGGAMLLVTYEYL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 75/294 (26%)
Mito_carr 39..138 CDD:278578 26/93 (28%)
Mito_carr 142..239 CDD:278578 24/98 (24%)
Mito_carr 248..336 CDD:278578 22/88 (25%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 75/294 (26%)
Mito_carr 17..104 CDD:278578 25/90 (28%)
Mito_carr 109..196 CDD:278578 25/95 (26%)
Mito_carr 216..295 CDD:278578 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.