DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and colt

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:284 Identity:71/284 - (25%)
Similarity:122/284 - (42%) Gaps:23/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYS 120
            |:.:|||..|.|||.....|   .|:..: |||....|....:.||...|::|::..|.......
  Fly    31 LSGHPLDTIKVRLQTMPRPA---PGEQPL-YRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIF 91

  Fly   121 GVRICSYDLMRKEFTQNGTQA-LPVWKSALCGVTAGAVAQWLASPADLVKVQIQME----GRRRL 180
            .:....|.| .|...|.|..| |...:..:.|..:|..:..:.:|.:.:||.:|.:    |.|:.
  Fly    92 AMCFAGYAL-GKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKY 155

  Fly   181 MGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCH 245
            .|   .:..||..:::    ||::.::|||...:.|....|......|:.::.:..::.:.....
  Fly   156 NG---MIDCAGKLYKE----GGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKSETGQIS 213

  Fly   246 TVH-VLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKG 309
            |.. :.|...||....|:|.||||:|:|:.:.|     .|....|.....:..:.|:|.:|||:|
  Fly   214 TASTIFAGGVAGMAYWILGMPADVLKSRLQSAP-----EGTYKHGIRSVFKDLIVKDGPLALYRG 273

  Fly   310 FLPCWIRMAPWSLTFWLSFEQIRK 333
            ..|..:|..|.:...:...|...|
  Fly   274 VTPIMLRAFPANAACFFGIELANK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 71/284 (25%)
Mito_carr 39..138 CDD:278578 23/81 (28%)
Mito_carr 142..239 CDD:278578 20/100 (20%)
Mito_carr 248..336 CDD:278578 25/87 (29%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 22/80 (28%)
Mito_carr 112..202 CDD:395101 20/96 (21%)
Mito_carr 210..299 CDD:395101 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.