DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and Rim2

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:306 Identity:66/306 - (21%)
Similarity:108/306 - (35%) Gaps:92/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AASIAELATYPLDLTKTRLQIQ-------------GEGAAHSAGKSNMQYRGMVATAFGIAREEG 101
            |.::..:.|.||::.|||||..             |.|.| :.|:|.            :.|.|.
  Fly    18 AGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPA-NGGQSE------------LLRPEQ 69

  Fly   102 ALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPAD 166
            ..||...:.....:..|..|||                   .:...:.||:::       .:|..
  Fly    70 RRKLSTTILRNRSQPQVIGGVR-------------------RIMAISHCGISS-------TTPKS 108

  Fly   167 LVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTI 231
            :..||                     ..|.|||..|.:.|:||..||:...|........||...
  Fly   109 MSIVQ---------------------CLRHIVQNEGPRALFKGLGPNLVGVAPSRAIYFCTYSQT 152

  Fly   232 KHLIMNRLQM--PDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSV--- 291
            |: .:|.|..  .|...||::::..||||::....|...||||:.          |.|...|   
  Fly   153 KN-TLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQ----------LDYNSKVQMT 206

  Fly   292 --DCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMI 335
              .|:.:..::.|..|.|||....:..:.. ::..::.:|.|:..:
  Fly   207 VRQCIERVYAQGGVAAFYKGITASYFGICE-TMVHFVIYEFIKSKL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 66/304 (22%)
Mito_carr 39..138 CDD:278578 22/100 (22%)
Mito_carr 142..239 CDD:278578 20/96 (21%)
Mito_carr 248..336 CDD:278578 21/93 (23%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 41/198 (21%)
Mito_carr 163..253 CDD:278578 23/100 (23%)
Mito_carr 268..355 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.