DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and sesB

DIOPT Version :10

Sequence 1:NP_573246.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:89 Identity:17/89 - (19%)
Similarity:37/89 - (41%) Gaps:17/89 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EEDYTLQSNLKKLVEKAGNSSDKEGQLAAVQAARRLLSSDRNPPI--------------NNLIDS 110
            :||...:.:.::.::.....|.|..:...::.|.|:...||:..|              |||.||
  Fly    63 DEDGNGEVDFREFIQGISQFSVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMVGNNLKDS 127

  Fly   111 GILPILVNCL---EQDDNQVLQFE 131
            .:..|:...:   ::|.:..:.|:
  Fly   128 QLQQIVDKTILFHDKDGDGKISFQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_573246.1 Mito_carr 39..138 CDD:395101 17/89 (19%)
Mito_carr 142..239 CDD:395101
Mito_carr 248..336 CDD:395101
sesBNP_727448.1 PTZ00169 23..312 CDD:240302 17/89 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.