DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG1628

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:310 Identity:75/310 - (24%)
Similarity:136/310 - (43%) Gaps:37/310 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IVSVVAASIAELA----TYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALK- 104
            ::..:|.|:...|    :.|||..|.:||...|.           ||||:.......|::|.|: 
  Fly   170 LIDFLAGSLGGAAQVYVSQPLDTVKVKLQTFPEA-----------YRGMLDCFLSTYRKDGVLRG 223

  Fly   105 LWQGVTPALYRHVVYSGVRICSYDLMRK--EFTQNGTQA--LPVWKSALCGVTAGAVAQWLASPA 165
            |:.|..||::.:|..:.|...:|...:|  .|......|  |...::|..|..|...:.....|.
  Fly   224 LYAGSVPAVFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPT 288

  Fly   166 DLVKVQIQMEGRRRLMGEPPR---VHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTT 227
            :|:|.::|.....:...||..   :.:.....|.|.:..||:|.::|......|..........:
  Fly   289 ELIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGS 353

  Fly   228 YDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAI-MGT---PADVVKTRIMNQPTDENGRGLLYR 288
            |:..:.|:....|..|  .:..|.::.||.:..: :.|   ||||:|:||..:..:|:    ::.
  Fly   354 YEGTRELLRRDDQSKD--DIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNES----MFA 412

  Fly   289 GSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIGAS 338
            ...|.:|    :||.:|||:|.||..:|..|.:.|.::.:|..::.:.|:
  Fly   413 VGADIVR----REGVLALYRGLLPSVLRTIPATATLFVVYEYTKRALSAT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 74/305 (24%)
Mito_carr 39..138 CDD:278578 26/99 (26%)
Mito_carr 142..239 CDD:278578 19/99 (19%)
Mito_carr 248..336 CDD:278578 26/91 (29%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 74/305 (24%)
Mito_carr 170..252 CDD:278578 24/92 (26%)
Mito_carr 263..364 CDD:278578 19/100 (19%)
Mito_carr 369..455 CDD:278578 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.