DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and Slc25a34

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001013958.2 Gene:Slc25a34 / 298606 RGDID:1359157 Length:318 Species:Rattus norvegicus


Alignment Length:329 Identity:104/329 - (31%)
Similarity:163/329 - (49%) Gaps:33/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TSSNPAPSS-GRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSA 79
            |.:..||:: .|..:.|         |...::...|..:|.:.|.||::.|||||:|||  ..:.
  Rat     4 TQAQMAPATDSREMVSP---------AVDLVLGASACCLACVFTNPLEVVKTRLQLQGE--LQAP 57

  Fly    80 GKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPV 144
            |.....|||.|::...:||.:|...|.:|:...|....:.:|||...|.|.    .|.|....| 
  Rat    58 GTYPRPYRGFVSSVTAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSLA----CQAGLTQQP- 117

  Fly   145 WKSALCGVTAGAVAQWLASPADLVKVQIQME-GRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWK 208
            ..:.:.|..|||:..::.|||.|||.|:|.: |....:|...:......|...|.::.|:.|||:
  Rat   118 GGTVVAGAVAGALGAFVGSPAYLVKTQLQAQTGAAVAVGHQHQHQGVLSALETIWRQQGMLGLWR 182

  Fly   209 GSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQ-MPDCHTVHVLASVCAGFVAAI----MGTPADV 268
            |....|.|..:.:...|.|:.:.|..:.::.. :.|..    ||::..|.:::|    :..|.||
  Rat   183 GVGAAVPRVTVGSAAQLATFTSAKAWVQDQQWFLEDSW----LATLAGGMISSIAVVAVMAPFDV 243

  Fly   269 VKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAP---WSLTFWLSFEQ 330
            |.||:.|||.|..|||.||.|..|||.:|..:||.:|||||..|.::|:.|   .|:.||   ::
  Rat   244 VSTRLYNQPVDRAGRGQLYGGLTDCLVKTCQQEGPLALYKGVGPAYLRLGPHTILSMFFW---DE 305

  Fly   331 IRKM 334
            :||:
  Rat   306 LRKL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 99/305 (32%)
Mito_carr 39..138 CDD:278578 31/98 (32%)
Mito_carr 142..239 CDD:278578 27/97 (28%)
Mito_carr 248..336 CDD:278578 39/94 (41%)
Slc25a34NP_001013958.2 Solcar 1 18..111 31/107 (29%)
Mito_carr 18..105 CDD:278578 29/97 (30%)
Solcar 2 115..208 27/93 (29%)
Mito_carr <133..211 CDD:278578 22/77 (29%)
Mito_carr 217..309 CDD:278578 39/98 (40%)
Solcar 3 218..309 39/97 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.