DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and Ucp1

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_036814.1 Gene:Ucp1 / 24860 RGDID:3931 Length:307 Species:Rattus norvegicus


Alignment Length:322 Identity:102/322 - (31%)
Similarity:168/322 - (52%) Gaps:28/322 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VASSTSSNPAPSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAA 76
            :.|||:|...|:.|      ||...|...||          :|::.|:|||..|.||||||||.|
  Rat     1 MVSSTTSEVQPTMG------VKIFSAGVSAC----------LADIITFPLDTAKVRLQIQGEGQA 49

  Fly    77 HSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQA 141
                .|.::|:|::.|...:|:.||..||:.|:...:.|.:.::.:||..||.:::.|:......
  Rat    50 ----SSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETP 110

  Fly   142 LPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGL 206
            ..:......|:..|.||.::..|.::|||  :|:.:..|.|..||.....:|:|.|.....:..|
  Rat   111 ASLGSKISAGLMTGGVAVFIGQPTEVVKV--RMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTL 173

  Fly   207 WKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKT 271
            |||:.||:.|..::|..:|.|||.:|..::|...:.|....|:|:::.|||...::.:|.|||||
  Rat   174 WKGTTPNLMRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKT 238

  Fly   272 RIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333
            |.:|....:      |.....|.....:|||..|.:|||.|.::|:..|::..::.|||::|
  Rat   239 RFINSLPGQ------YPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 93/295 (32%)
Mito_carr 39..138 CDD:278578 33/98 (34%)
Mito_carr 142..239 CDD:278578 30/96 (31%)
Mito_carr 248..336 CDD:278578 29/86 (34%)
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 37/112 (33%)
Solcar 1 11..102 37/110 (34%)
PTZ00169 21..297 CDD:240302 93/296 (31%)
Mito_carr 110..205 CDD:278578 29/96 (30%)
Solcar 2 111..201 29/91 (32%)
Solcar 3 210..295 30/91 (33%)
Mito_carr 215..300 CDD:278578 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.