DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and misc-1

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_493694.2 Gene:misc-1 / 173414 WormBaseID:WBGene00015186 Length:306 Species:Caenorhabditis elegans


Alignment Length:301 Identity:87/301 - (28%)
Similarity:145/301 - (48%) Gaps:23/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGI 96
            |||.:..:          |...|.|...||||.|.|:|:.|     :.||.  :||..:.....|
 Worm    11 VKFAFGGT----------AGMGATLVVQPLDLVKNRMQLSG-----TTGKK--EYRSSMHALTSI 58

  Fly    97 AREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWL 161
            .:.||...::.|::..|.|...|:..|:.:|..:.:.||:. .:.|.....|:.|:|||.:..::
 Worm    59 MKNEGVFAVYNGLSAGLLRQATYTTTRLGTYAFLLERFTEK-DKPLSFGMKAVLGMTAGGIGSFV 122

  Fly   162 ASPADLVKVQIQMEGRRRLMGEPPRVHS-AGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDL 225
            .:||::  ..|:|.|..||..|..|.:: ..:|..:|.:..|:..||:|..|.|.||.:||...|
 Worm   123 GTPAEI--ALIRMTGDGRLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQL 185

  Fly   226 TTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGS 290
            .||...|..::...::.|....|.|||:.:|....|...|.|:.||||.:....:....  |:.:
 Worm   186 ATYSQAKQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKPE--YKNA 248

  Fly   291 VDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQI 331
            .|...:.:..||..||:|||.|.::|:.|.::..::..||:
 Worm   249 FDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 84/294 (29%)
Mito_carr 39..138 CDD:278578 26/98 (27%)
Mito_carr 142..239 CDD:278578 31/97 (32%)
Mito_carr 248..336 CDD:278578 26/84 (31%)
misc-1NP_493694.2 Mito_carr 7..99 CDD:278578 29/104 (28%)
Mito_carr 101..196 CDD:278578 31/96 (32%)
Mito_carr 202..296 CDD:278578 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.