DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and Slc25a10

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:288 Identity:90/288 - (31%)
Similarity:144/288 - (50%) Gaps:20/288 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPAL 113
            :|:..|...|:||||.|..||.|.|          ::.| |...|..:.|.:|.|.|:.|::.:|
  Rat    14 LASCGAACCTHPLDLLKVHLQTQQE----------VKLR-MTGMALQVVRTDGFLALYNGLSASL 67

  Fly   114 YRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRR 178
            .|.:.||..|...|:.||...|::....||.:...|.|..:|....::.:|||||.|::|.:.:.
  Rat    68 CRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDMKL 132

  Fly   179 RLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPD 243
            .|.......|:....:| :.:..|:|.|:.|:.....|.|||.:|.|:.||..|.|:::...:.|
  Rat   133 PLSQRRNYSHALDGLYR-VAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSD 196

  Fly   244 CHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYK 308
            ....|.|:|..||..|..:..|.||:|||:||...:       |:|...|..:| :|.|..|.:|
  Rat   197 NIFTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGE-------YQGVFHCAVET-AKLGPQAFFK 253

  Fly   309 GFLPCWIRMAPWSLTFWLSFEQIRKMIG 336
            |.:|..:|:.|.::..::..||:||..|
  Rat   254 GLVPAGVRLVPHTVLTFMFLEQLRKHFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 89/285 (31%)
Mito_carr 39..138 CDD:278578 29/88 (33%)
Mito_carr 142..239 CDD:278578 29/96 (30%)
Mito_carr 248..336 CDD:278578 30/87 (34%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 29/88 (33%)
Mito_carr 94..189 CDD:395101 29/95 (31%)
Mito_carr 197..283 CDD:395101 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.