DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and SLC25A10

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:182 Identity:53/182 - (29%)
Similarity:86/182 - (47%) Gaps:22/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPAL 113
            :|:..|...|:||||.|..||.|.|          ::.| |...|..:.|.:|.|.|:.|::.:|
Human    15 LASCGAACCTHPLDLLKVHLQTQQE----------VKLR-MTGMALRVVRTDGILALYSGLSASL 68

  Fly   114 YRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQ----- 173
            .|.:.||..|...|:.:|....:.....||..:..|.|..:|....::.:|||||.|::|     
Human    69 CRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKL 133

  Fly   174 MEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDL 225
            .:|:||     ...|:....:| :.:..|::.|:.|:.....|.|||.:|.|
Human   134 PQGQRR-----NYAHALDGLYR-VAREEGLRRLFSGATMASSRGALVTVGQL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 53/182 (29%)
Mito_carr 39..138 CDD:278578 27/88 (31%)
Mito_carr 142..239 CDD:278578 26/89 (29%)
Mito_carr 248..336 CDD:278578
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 27/88 (31%)
Mito_carr 95..179 CDD:278578 25/89 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.