DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and slc25a34

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001135591.1 Gene:slc25a34 / 100216146 XenbaseID:XB-GENE-5994554 Length:301 Species:Xenopus tropicalis


Alignment Length:298 Identity:101/298 - (33%)
Similarity:149/298 - (50%) Gaps:21/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108
            :::...|..:|.:.|.||::.|||||:|||  ..|.|.....|||::.....:.:.:|...|.:|
 Frog     9 FVLGASACCMACVFTNPLEVVKTRLQLQGE--LRSRGTYTRHYRGVLQAMVAVGQADGLRGLQKG 71

  Fly   109 VTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQ 173
            :|..|....:.:|||...|    ......|....|....| .|..|||...::.|||.|||..:|
 Frog    72 LTAGLLYQAMMNGVRFYLY----SHAEGIGLTEQPGGNIA-AGAVAGATGAFVGSPAYLVKTHLQ 131

  Fly   174 MEGRRRL-MGEPPRVHSAGHAFRQIVQRGGIKGLWK---GSIPNVQRAALVNLGDLTTYDTIKHL 234
            .:....: :|......|...||..|.::.||.|||:   |::|.|...:.|   .|.|:...|..
 Frog   132 AQTVAAIAVGHQHNHQSVSSAFETIYKKQGILGLWRGVNGAVPRVMVGSAV---QLATFANAKEW 193

  Fly   235 IMNRLQMP-DCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTV 298
            :..:...| |...|.:...:.:....||..||.|||.||:.|||.|.:|:|.||||.:||:.:.:
 Frog   194 VKKQQWFPHDSWLVALTGGMISSIGVAIAMTPFDVVSTRLYNQPVDSSGKGRLYRGFLDCILKII 258

  Fly   299 SKEGFVALYKGFLPCWIRMAP---WSLTFWLSFEQIRK 333
            .|||.:|||||.:|.:||:.|   .||.||   |::||
 Frog   259 HKEGVLALYKGIVPAYIRLGPHTILSLLFW---EELRK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 101/298 (34%)
Mito_carr 39..138 CDD:278578 27/93 (29%)
Mito_carr 142..239 CDD:278578 30/100 (30%)
Mito_carr 248..336 CDD:278578 40/89 (45%)
slc25a34NP_001135591.1 Mito_carr 3..90 CDD:278578 26/82 (32%)
Mito_carr <118..196 CDD:278578 24/80 (30%)
Mito_carr 202..294 CDD:278578 42/95 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.