DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and ucp1

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001107354.1 Gene:ucp1 / 100135179 XenbaseID:XB-GENE-963773 Length:309 Species:Xenopus tropicalis


Alignment Length:305 Identity:110/305 - (36%)
Similarity:174/305 - (57%) Gaps:12/305 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATA 93
            |:|  .|...:.|..:|.:..||.||:|.|:|||..|.||||||| ...|...:.::|:|:..|.
 Frog     4 LKP--SDVPPTPAVKFIAAGTAACIADLFTFPLDTAKVRLQIQGE-TTGSGAANGIRYKGVFGTI 65

  Fly    94 FGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVA 158
            ..|.:.||...|:.|:...|.|.:.::.:||..||.: |.|..||.:...:....|.|.|.||:|
 Frog    66 STIVKTEGPKSLYNGLVAGLQRQMSFASIRIGLYDTV-KLFYTNGKEKAGIGSRILAGCTTGALA 129

  Fly   159 QWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLG 223
            ..:|.|.|:|||:.|.:.  .|.|...|.:....|::.|.::.|::|||||:.|||.|.|:||..
 Frog   130 VTVAQPTDVVKVRFQAQA--NLQGVKRRYNGTMDAYKTIAKKEGVRGLWKGTFPNVTRNAIVNCT 192

  Fly   224 DLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYR 288
            :|.|||.||..:::...|.|....|.:::..|||...::.:|.||||||.||.|..:      |:
 Frog   193 ELVTYDVIKENLLHYKLMTDNLPCHFVSAFGAGFCTTVIASPVDVVKTRYMNSPPGQ------YK 251

  Fly   289 GSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333
            .:::|....::|||..|.||||:|.::|:..|::..::|:||:::
 Frog   252 SALNCAWTMITKEGPTAFYKGFVPSFLRLGSWNVVMFVSYEQLKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 107/295 (36%)
Mito_carr 39..138 CDD:278578 36/98 (37%)
Mito_carr 142..239 CDD:278578 37/96 (39%)
Mito_carr 248..336 CDD:278578 30/86 (35%)
ucp1NP_001107354.1 Mito_carr 10..110 CDD:278578 37/101 (37%)
PTZ00169 14..299 CDD:240302 107/293 (37%)
Mito_carr 111..208 CDD:278578 37/98 (38%)
Mito_carr 211..302 CDD:278578 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.