DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and RFC4

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_014547.1 Gene:RFC4 / 854059 SGDID:S000005454 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:112/323 - (34%)
Similarity:186/323 - (57%) Gaps:29/323 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PWVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIFGDMFKDR 95
            ||||||||:.:.|:|...|.:..|::..:.|::|:|::.|.||.|||:::...:.::.|..:.|.
Yeast    10 PWVEKYRPQVLSDIVGNKETIDRLQQIAKDGNMPHMIISGMPGIGKTTSVHCLAHELLGRSYADG 74

  Fly    96 ILELNASDERGINVVRTKIKNFSQLSASSVRPDGKPCPPFKIIILDEADSMTHAAQSALRRTMEK 160
            :|||||||:|||:|||.:||:|:|....  .|.||    .||:|||||||||..||.|||||||.
Yeast    75 VLELNASDDRGIDVVRNQIKHFAQKKLH--LPPGK----HKIVILDEADSMTAGAQQALRRTMEL 133

  Fly   161 ESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDKVIDRLKYICEMEGVKIEDDAYKSIVKIS 225
            .|.||||...||..::||.|:.|||:..|:..|.::.|:.||..|.::|.||..:|..::|:..:
Yeast   134 YSNSTRFAFACNQSNKIIEPLQSRCAILRYSKLSDEDVLKRLLQIIKLEDVKYTNDGLEAIIFTA 198

  Fly   226 GGDLRRAITTLQSCYRLKGPEHIINTADLFE---------MSGVIPEYYLEDYLEVCRSGNYERL 281
            .||:|:||..|||.....|   ::|..::|:         :..::....|||.:::.|:..:::.
Yeast   199 EGDMRQAINNLQSTVAGHG---LVNADNVFKIVDSPHPLIVKKMLLASNLEDSIQILRTDLWKKG 260

  Fly   282 EQFVREIGFSAYSVGQMMEQFVEFIVHHPGLNDPQKATICDKLGECCFRLQDGGSEYLQIMDL 344
            ...: :|..:::.|.:.:.|..|.:          :..:..::|....|:.:|...|||:..:
Yeast   261 YSSI-DIVTTSFRVTKNLAQVKESV----------RLEMIKEIGLTHMRILEGVGTYLQLASM 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 112/321 (35%)
AAA 45..187 CDD:99707 67/141 (48%)
AAA_assoc_2 211..>256 CDD:292811 14/44 (32%)
Rep_fac_C <293..344 CDD:285713 9/50 (18%)
RFC4NP_014547.1 PLN03025 9..323 CDD:178596 112/323 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.