DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and RFC5

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_009644.3 Gene:RFC5 / 852383 SGDID:S000000291 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:368 Identity:103/368 - (27%)
Similarity:164/368 - (44%) Gaps:69/368 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WVEKYRPRNVDDVVEQSEVVAVLRKCV-EGGDLPNMLLYGPPGTGKTSTILAASRQIFGD----- 90
            ||:||||::::.:....|:...|:... :..|||::|||||.||||.:..:|....|||.     
Yeast     4 WVDKYRPKSLNALSHNEELTNFLKSLSDQPRDLPHLLLYGPNGTGKKTRCMALLESIFGPGVYRL 68

  Fly    91 --------MFKDRILELN----------ASDERGIN---VVRTKIKNFSQLSASSVRPDGKP--C 132
                    ...:|.||||          ...:.|.|   |::..:|..:|:.....: |.|.  .
Yeast    69 KIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLKEVAQMEQVDFQ-DSKDGLA 132

  Fly   133 PPFKIIILDEADSMTHAAQSALRRTMEKESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDK 197
            ..:|.:|::||:|:|..||:||||||||.|::.|..::|:.:|.||.||.|||...|..|..:.:
Yeast   133 HRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSMSPIIAPIKSRCLLIRCPAPSDSE 197

  Fly   198 VIDRLKYICEMEGVKIE-DDAYKSIVKISGGDLRRAITTLQSC-----YRLKG------PEHIIN 250
            :...|..:...|.:::| .|..|.|.:.|.|:||.::..|:|.     ..||.      |:.||.
Yeast   198 ISTILSDVVTNERIQLETKDILKRIAQASNGNLRVSLLMLESMALNNELALKSSSPIIKPDWIIV 262

  Fly   251 TADLFEMSGVIPEYYLEDYLEVCRSGNYERLEQ------FVREIGFSAYSVGQMMEQFVEFIVHH 309
            ...|...  ::.|..:...:| ||:..|:.|..      .::|:.||...|              
Yeast   263 IHKLTRK--IVKERSVNSLIE-CRAVLYDLLAHCIPANIILKELTFSLLDV-------------- 310

  Fly   310 PGLNDPQKATICDKLGECCFRLQDGGSEYLQ----IMDLGCCI 348
            ..||...|::|.:.......||..|......    |..:.||:
Yeast   311 ETLNTTNKSSIIEYSSVFDERLSLGNKAIFHLEGFIAKVMCCL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 101/362 (28%)
AAA 45..187 CDD:99707 57/170 (34%)
AAA_assoc_2 211..>256 CDD:292811 16/56 (29%)
Rep_fac_C <293..344 CDD:285713 9/54 (17%)
RFC5NP_009644.3 PRK12402 3..>243 CDD:237090 77/239 (32%)
HolB 161..351 CDD:223546 49/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.