DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and RFC3

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_002906.1 Gene:RFC3 / 5983 HGNCID:9971 Length:356 Species:Homo sapiens


Alignment Length:268 Identity:84/268 - (31%)
Similarity:126/268 - (47%) Gaps:45/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIFG-DMFKDR 95
            ||:||||.::..:....|..|.||..|:.||.|::|:|||.|.||.:.|:...|:::| .:.|.|
Human     4 WVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLR 68

  Fly    96 I-----------------------LELNASDERGIN--VVRTKIKNFS---QLSASSVRPDGKPC 132
            |                       ||:|.||....:  |::..:|..:   ||..:|.|      
Human    69 IEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQR------ 127

  Fly   133 PPFKIIILDEADSMTHAAQSALRRTMEKESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDK 197
             .||:::|.|.|.:|..||.||||||||...:.|..|.||..|::|.||.|||...|..|...:.
Human   128 -DFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIED 191

  Fly   198 VIDRLKYICEMEGVKIEDDAYKSIVKISGGDLRRAITTLQSCYRLKGPEHIINTADLFEMSGVIP 262
            :...|..:|:.||:.:.......:.:.|..:||:|:...::|...:.|         |.....||
Human   192 ICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYP---------FTADQEIP 247

  Fly   263 EYYLEDYL 270
            |...|.||
Human   248 ETDWEVYL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 84/268 (31%)
AAA 45..187 CDD:99707 59/170 (35%)
AAA_assoc_2 211..>256 CDD:292811 6/44 (14%)
Rep_fac_C <293..344 CDD:285713
RFC3NP_002906.1 PRK12402 3..339 CDD:237090 84/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.