DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and RAD17

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_579917.1 Gene:RAD17 / 5884 HGNCID:9807 Length:681 Species:Homo sapiens


Alignment Length:419 Identity:82/419 - (19%)
Similarity:143/419 - (34%) Gaps:135/419 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KTGKSTAGSGDKSQGTPAARR-------------------KPPAPWVEKYRP----------RNV 41
            |.|.||.    :|...||.:|                   ....|||:||:|          :.:
Human    50 KNGPSTL----ESSRFPARKRGNLSSLEQIYGLENSKEYLSENEPWVDKYKPETQHELAVHKKKI 110

  Fly    42 DDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQ-----------IFGDMFKDR 95
            ::|....:...:.|:..:||.:  :|:.||||.|||:|:...|::           :..|..|| 
Human   111 EEVETWLKAQVLERQPKQGGSI--LLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKD- 172

  Fly    96 ILELNASDERGI---------------------NVVRTKIKNFSQLSASSVRPDGKPCPPFKIII 139
                   |.:|:                     .::|....|..|:....:|.|.      |||:
Human   173 -------DFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDK------KIIL 224

  Fly   140 LDEADSMTHAAQSALRRTMEKESRSTRFCLICNYVS---------RIIVP--ITSRC--SKFRFK 191
            :::..:..:.....|...:.|..|..| |.:...:|         |::.|  |...|  |...|.
Human   225 VEDLPNQFYRDSHTLHEVLRKYVRIGR-CPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFN 288

  Fly   192 ALGEDKVIDRLKYICEME----GVKI---EDDAYKSIVKISGGDLRRAITTLQ------------ 237
            .:....::..|..|..:|    |.||   :..:.:.:.:...||:|.||.:||            
Human   289 PVAPTIMMKFLNRIVTIEANKNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGENNLRP 353

  Fly   238 --------------SCYRLKGPEHIINTADLFEMSGVIPEYYLEDYLE---VCRSGNYERLEQFV 285
                          ...|.|.|:.:....::..:.|.....:|...|.   .|:..:...|:...
Human   354 RKKGMSLKSDAVLSKSKRRKKPDRVFENQEVQAIGGKDVSLFLFRALGKILYCKRASLTELDSPR 418

  Fly   286 REIGFSAYSVGQMM---EQFVEFIVHHPG 311
            .....|.|....::   |:.|| :.|.||
Human   419 LPSHLSEYERDTLLVEPEEVVE-MSHMPG 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 74/375 (20%)
AAA 45..187 CDD:99707 36/186 (19%)
AAA_assoc_2 211..>256 CDD:292811 12/73 (16%)
Rep_fac_C <293..344 CDD:285713 7/22 (32%)
RAD17NP_579917.1 rad24 13..652 CDD:129690 82/419 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..61 5/14 (36%)
AAA_16 111..258 CDD:289934 32/163 (20%)
NK 135..>193 CDD:302627 14/65 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..377 3/32 (9%)
Interaction with MCM7. /evidence=ECO:0000269|PubMed:15538388 432..681 6/16 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.