DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and rfc5

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001011112.1 Gene:rfc5 / 496525 XenbaseID:XB-GENE-1016200 Length:335 Species:Xenopus tropicalis


Alignment Length:347 Identity:125/347 - (36%)
Similarity:191/347 - (55%) Gaps:49/347 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KSQGTPAARRKPPAPWVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTIL 81
            :::|.|...|.  .||||||||:.:||::...::::.:::.:....||::|.|||||||||||||
 Frog     4 ENKGQPGQSRN--LPWVEKYRPQTLDDLISHQDILSTIQRFISEDKLPHLLFYGPPGTGKTSTIL 66

  Fly    82 AASRQIFGDM-FKDRILELNASDERGINVVRTKIKNFSQLSASSVRPDGKPCPPFKIIILDEADS 145
            |.::|::.|. |...:|||||||:|||::||..|.:|:  |..::...|     ||::||||||:
 Frog    67 ACAKQLYKDREFNSMVLELNASDDRGIDIVRGPILSFA--STRTIFKKG-----FKLVILDEADA 124

  Fly   146 MTHAAQSALRRTMEKESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDKVIDRLKYICEMEG 210
            ||..||:||||.:||.:.:|||||||||:|:||..:.|||::|||..|..:.::.||:::.:.|.
 Frog   125 MTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLSPEMMVPRLEHVVKEEC 189

  Fly   211 VKIEDDAYKSIVKISGGDLRRAITTLQSCYRLKGPEHIINTADLFEMSGVIPEYYLEDYLEVC-- 273
            |.|..|..|::|.:|.||:||::..|||.....|.                   ..||.:..|  
 Frog   190 VDISPDGMKALVTLSNGDMRRSLNILQSTNMAYGK-------------------VTEDTVYTCTG 235

  Fly   274 ---RSGNYERLEQFVREIGFSAYSVGQMME-------------QFVEFIVHHPGLNDPQKATICD 322
               ||.....|:..:.:...|||.  .:||             ..|...||........:..:..
 Frog   236 HPLRSDIANILDWMLNKDFTSAYK--NIMELKTLKGLALHDILTEVHLYVHRVDFPASVRMHLLI 298

  Fly   323 KLGECCFRLQDGGSEYLQIMDL 344
            |:.:..:||..|.||.:|:..|
 Frog   299 KMADVEYRLASGTSEKIQLSSL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 121/331 (37%)
AAA 45..187 CDD:99707 69/142 (49%)
AAA_assoc_2 211..>256 CDD:292811 14/44 (32%)
Rep_fac_C <293..344 CDD:285713 13/63 (21%)
rfc5NP_001011112.1 rfc 13..324 CDD:234763 123/338 (36%)
AAA 30..171 CDD:99707 72/147 (49%)
AAA_assoc_2 190..>215 CDD:292811 10/24 (42%)
Rep_fac_C 253..322 CDD:285713 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.