DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and Rad17

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001019949.1 Gene:Rad17 / 310034 RGDID:1309515 Length:686 Species:Rattus norvegicus


Alignment Length:267 Identity:63/267 - (23%)
Similarity:106/267 - (39%) Gaps:75/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PWVEKYRPRNVDDVVEQSEVVAVLRKCVE-----------------GGDLPNMLLYGPPGTGKTS 78
            |||:||:|       |....:||.:|.:|                 ||.:  :|:.||||.|||:
  Rat    89 PWVDKYKP-------ETQHELAVHKKKIEEVETWLKTQVLEVKPKHGGSI--LLITGPPGCGKTT 144

  Fly    79 TILAASRQ-----------IFGDMFKDRILEL-NASDERGINVVRTKIKNFS------------Q 119
            ||...|::           |..|..||...|| |:.....:...:::|..|:            |
  Rat   145 TIKILSKELGIQVQEWVNPILQDFQKDDYKELFNSESNFSVIPYQSQIAVFNDFLLRATKYNKLQ 209

  Fly   120 LSASSVRPDGKPCPPFKIIILDEADSMTHAAQSALRRTMEKE---SRSTRFCLICNYVS-----R 176
            :...::..|.      |||::::..:..:...:||...:.|.   .|.....::.:.||     |
  Rat   210 MLGDALTTDK------KIILVEDLPNQFYRDANALHEILRKYVHIGRCPLVFIVSDSVSGDSNHR 268

  Fly   177 IIVP--ITSRC--SKFRFKALGEDKVIDRLKYICEME----GVKI---EDDAYKSIVKISGGDLR 230
            ::.|  |...|  |...|..:....::..|..|..:|    |.||   ...:.:.:.:...||:|
  Rat   269 LLFPKNIQEECSVSNISFNPVAPTIMMKFLNRIVTIEASKNGEKITVPNKASLELLCQGCSGDIR 333

  Fly   231 RAITTLQ 237
            .||.:||
  Rat   334 SAINSLQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 63/267 (24%)
AAA 45..187 CDD:99707 42/194 (22%)
AAA_assoc_2 211..>256 CDD:292811 9/30 (30%)
Rep_fac_C <293..344 CDD:285713
Rad17NP_001019949.1 rad24 13..651 CDD:129690 63/267 (24%)
AAA_18 133..>253 CDD:289979 29/125 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.