DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and Rfc3

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001009629.1 Gene:Rfc3 / 288414 RGDID:1306832 Length:356 Species:Rattus norvegicus


Alignment Length:268 Identity:85/268 - (31%)
Similarity:127/268 - (47%) Gaps:45/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIFG-DMFKDR 95
            ||:||||.::..:....|..|.||..|:.||.|::|:|||.|.||.:.|:...|:::| .:.|.|
  Rat     4 WVDKYRPSSLARLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLR 68

  Fly    96 I-----------------------LELNASDERGIN--VVRTKIKNFS---QLSASSVRPDGKPC 132
            |                       ||:|.||....:  |::..:|..:   ||..||.|      
  Rat    69 IEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETSSQR------ 127

  Fly   133 PPFKIIILDEADSMTHAAQSALRRTMEKESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDK 197
             .||:::|.|.|.:|..||.||||||||...:.|..|.||..|::|.||.|||...|..|...:.
  Rat   128 -DFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAIRVPAPSIED 191

  Fly   198 VIDRLKYICEMEGVKIEDDAYKSIVKISGGDLRRAITTLQSCYRLKGPEHIINTADLFEMSGVIP 262
            :...|..:|:.||:.:.....:.:.:.|..:||:|:...::|...:.|         |.....||
  Rat   192 ICSVLSTVCKKEGLALPSKLARRLAEKSCRNLRKALLMCEACRVQQYP---------FTEDQEIP 247

  Fly   263 EYYLEDYL 270
            |...|.||
  Rat   248 ETDWEVYL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 85/268 (32%)
AAA 45..187 CDD:99707 60/170 (35%)
AAA_assoc_2 211..>256 CDD:292811 6/44 (14%)
Rep_fac_C <293..344 CDD:285713
Rfc3NP_001009629.1 PRK12402 3..339 CDD:237090 85/268 (32%)
AAA 21..187 CDD:99707 61/172 (35%)
Rep_fac_C 250..337 CDD:285713 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.