Sequence 1: | NP_573245.1 | Gene: | CG8142 / 32763 | FlyBaseID: | FBgn0030871 | Length: | 353 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001009629.1 | Gene: | Rfc3 / 288414 | RGDID: | 1306832 | Length: | 356 | Species: | Rattus norvegicus |
Alignment Length: | 268 | Identity: | 85/268 - (31%) |
---|---|---|---|
Similarity: | 127/268 - (47%) | Gaps: | 45/268 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 WVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIFG-DMFKDR 95
Fly 96 I-----------------------LELNASDERGIN--VVRTKIKNFS---QLSASSVRPDGKPC 132
Fly 133 PPFKIIILDEADSMTHAAQSALRRTMEKESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDK 197
Fly 198 VIDRLKYICEMEGVKIEDDAYKSIVKISGGDLRRAITTLQSCYRLKGPEHIINTADLFEMSGVIP 262
Fly 263 EYYLEDYL 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8142 | NP_573245.1 | rfc | 31..344 | CDD:234763 | 85/268 (32%) |
AAA | 45..187 | CDD:99707 | 60/170 (35%) | ||
AAA_assoc_2 | 211..>256 | CDD:292811 | 6/44 (14%) | ||
Rep_fac_C | <293..344 | CDD:285713 | |||
Rfc3 | NP_001009629.1 | PRK12402 | 3..339 | CDD:237090 | 85/268 (32%) |
AAA | 21..187 | CDD:99707 | 61/172 (35%) | ||
Rep_fac_C | 250..337 | CDD:285713 | 3/6 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0470 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1071197at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |