DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and Rfc2

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_064406.1 Gene:Rfc2 / 19718 MGIID:1341868 Length:349 Species:Mus musculus


Alignment Length:329 Identity:122/329 - (37%)
Similarity:180/329 - (54%) Gaps:54/329 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PWVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIFGDMFKDR 95
            ||||||||..::::|...:.|:.|......|::||:::.||||||||::||..:|.:.|...||.
Mouse    32 PWVEKYRPLKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDA 96

  Fly    96 ILELNASDERGINVVRTKIKNFSQLSASSVRPDGKPCPPFKIIILDEADSMTHAAQSALRRTMEK 160
            :||||||::|||:|||.|||.|:|...:  .|.|:    .||||||||||||..||.|||||||.
Mouse    97 VLELNASNDRGIDVVRNKIKMFAQQKVT--LPKGR----HKIIILDEADSMTDGAQQALRRTMEI 155

  Fly   161 ESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDKVIDRLKYICEMEGVKIEDDAYKSIVKIS 225
            .|::|||.|.||...:||.||.|||:..|:..|.:.:|:.||..:.|.|.|...||..::|:..:
Mouse   156 YSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQVLTRLMNVIEKEKVPYTDDGLEAIIFTA 220

  Fly   226 GGDLRRAITTLQSCYRLKGPEHIINTADLFEMS-------------------------------- 258
            .||:|:|:..|||.:...|   .||:.::|::.                                
Mouse   221 QGDMRQALNNLQSTFSGFG---YINSENVFKVCDEPHPLLVKEMIQHCVDANIDEAYKILAHLWH 282

  Fly   259 -GVIPEYYLEDYLEVCRS---GNYERLEQFVREIGFSAYSVGQMMEQFVEFIVHHPGLNDPQKAT 319
             |..||..:.:...||::   ..|.:|| |::|||::...|.:.:...::.    .||    .|.
Mouse   283 LGYSPEDVIGNIFRVCKTFPMAEYLKLE-FIKEIGYTHMKVAEGVNSLLQM----AGL----LAR 338

  Fly   320 ICDK 323
            :|.|
Mouse   339 LCQK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 122/329 (37%)
AAA 45..187 CDD:99707 74/141 (52%)
AAA_assoc_2 211..>256 CDD:292811 14/44 (32%)
Rep_fac_C <293..344 CDD:285713 6/31 (19%)
Rfc2NP_064406.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
PLN03025 31..343 CDD:178596 122/329 (37%)
AAA 46..180 CDD:99707 72/139 (52%)
AAA_assoc_2 203..>231 CDD:292811 9/27 (33%)
Rep_fac_C 269..337 CDD:285713 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.