DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and rfc-3

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_502517.1 Gene:rfc-3 / 178259 WormBaseID:WBGene00004339 Length:354 Species:Caenorhabditis elegans


Alignment Length:308 Identity:91/308 - (29%)
Similarity:143/308 - (46%) Gaps:72/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 APWVEKYRPRN------VDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIF 88
            |.||:||||::      ||..:||:..:    |.:....:|::|..||.|.||.:.|....|:::
 Worm     2 ALWVDKYRPKDLLGKDGVDYHIEQANHL----KFLSADCMPHLLFCGPSGAGKKTRIKCLLRELY 62

  Fly    89 G-DMFKDRI-----------------------LELNASDERGIN---VVRTKIKNF---SQLSAS 123
            | .:.|.::                       :|:..||. ||.   ||:..:|..   ||:.::
 Worm    63 GVGVEKTQLIMKSFTSPSNKKLEIQTVSSNYHIEMTPSDV-GIYDRVVVQDLVKEMAQTSQIEST 126

  Fly   124 SVRPDGKPCPPFKIIILDEADSMTHAAQSALRRTMEKESRSTRFCLICNYVSRIIVPITSRCSKF 188
            |.|       .||:::|.||||:|..||..|||||||.:.:.:..|.|..:||||.|:.|||...
 Worm   127 SQR-------SFKVVVLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSRCIII 184

  Fly   189 RFKALGEDKVIDRLKYICEMEGVKIEDDAYKSIVKISGGDLRRAITTLQSCYRLKGPEHIINTAD 253
            ...|..::.|...|:.:.|.|...:.::..:.||:.|.|:||||| .:....|::      |.:.
 Worm   185 NVPAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKSEGNLRRAI-LMTEALRME------NESG 242

  Fly   254 LFEMSGVIP----EYYLE------------DYLEVCRSGNYERLEQFV 285
            :.| |.|||    |.|::            |.|...|...||.|.:.:
 Worm   243 VAE-SVVIPVPEWEIYIQETARLILQKQSSDMLLKVRERLYELLSRCI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 90/307 (29%)
AAA 45..187 CDD:99707 53/171 (31%)
AAA_assoc_2 211..>256 CDD:292811 11/44 (25%)
Rep_fac_C <293..344 CDD:285713
rfc-3NP_502517.1 PRK12402 3..342 CDD:237090 90/307 (29%)
AAA 38..187 CDD:99707 50/156 (32%)
Rep_fac_C 253..340 CDD:285713 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.