DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and rfc-2

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_500069.1 Gene:rfc-2 / 176946 WormBaseID:WBGene00004338 Length:334 Species:Caenorhabditis elegans


Alignment Length:336 Identity:116/336 - (34%)
Similarity:182/336 - (54%) Gaps:48/336 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 APWVEKYRPRNVDDVVEQSEVVAVLRKCVEGGDLPNMLLYGPPGTGKTSTILAASRQIFGDMFKD 94
            |||||||||:.:.|:|....:|..|:.....|::||::|.||||.|||:::.|.:|::.||..|:
 Worm    10 APWVEKYRPKVLADIVGNENIVERLKVIGHEGNVPNIVLSGPPGCGKTTSVWALARELLGDKVKE 74

  Fly    95 RILELNASDERGINVVRTKIKNFSQLSASSVRPDGKPCPPFKIIILDEADSMTHAAQSALRRTME 159
            .:|||||||||||:|||.:||.|:|...:  .|:|:    .||||||||||||..||.|||||||
 Worm    75 AVLELNASDERGIDVVRHRIKTFAQTKVT--LPEGR----HKIIILDEADSMTDGAQQALRRTME 133

  Fly   160 KESRSTRFCLICNYVSRIIVPITSRCSKFRFKALGEDKVIDRLKYICEMEGVKIEDDAYKSIVKI 224
            ..:::|||.|.||...:||.||.|||:..|:..|...:::.|:|.:.:.|.|..:|...::|:..
 Worm   134 MYTKTTRFALACNQSEKIIEPIQSRCALLRYTKLSPVQLLTRVKEVAKAEKVNYDDGGLEAILFT 198

  Fly   225 SGGDLRRAITTLQ---SCYRLKGPEHIINTAD------------------LFEMSGVIPEYYLED 268
            :.||:|:|:..||   :.|.|...|:::...|                  .||.|.:|.|::   
 Worm   199 AQGDMRQALNNLQATVNAYELVNKENVLKVCDEPHPDLMIKMLHYCTDRKFFEASKIIHEFH--- 260

  Fly   269 YLEVCRSGNYERLEQFVREIGFSAYSVGQMMEQFVEFIVHHPGLNDPQKATICDKLGECCFRLQD 333
                              .:|||:..:...:.:.|:.:.....:::..:.....::..|..|:..
 Worm   261 ------------------RLGFSSDDIVSTLFRVVKTVELSKNVSEQLRMEYIRQIAMCHMRIVQ 307

  Fly   334 GGSEYLQIMDL 344
            |.:..||:..|
 Worm   308 GLTSKLQLSRL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 114/333 (34%)
AAA 45..187 CDD:99707 73/141 (52%)
AAA_assoc_2 211..>256 CDD:292811 13/65 (20%)
Rep_fac_C <293..344 CDD:285713 6/50 (12%)
rfc-2NP_500069.1 PLN03025 11..325 CDD:178596 115/335 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.