DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and mdt-30

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_498749.1 Gene:mdt-30 / 176130 WormBaseID:WBGene00004125 Length:466 Species:Caenorhabditis elegans


Alignment Length:259 Identity:47/259 - (18%)
Similarity:97/259 - (37%) Gaps:94/259 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KTG----KSTAGSGDKSQGTPAARRKP-----PAPW----VEKYRPRN--------VDDV-VEQS 48
            :||    :::|.|..::|.|.|.:.:|     .:|.    :|||....        |:|: |:.|
 Worm   237 QTGHPPQQTSASSQQRAQETMAQQTEPQSHIRESPQKETNLEKYSTGELCLYGRELVNDLNVKTS 301

  Fly    49 EVVAVLRKCVE-----GGDLPNMLLYGPPGTGKTSTILAASRQIFGDMFKDRILELNASDERGIN 108
            .:..:|:|.:|     .|:.||.|                     .|..|:.:..:  ||.|.| 
 Worm   302 YLSTILKKVMERKPLNQGENPNDL---------------------ADQCKNALQRM--SDIRQI- 342

  Fly   109 VVRTKIKNFSQLSASSVRPDGKPCPPFKIIILDEADSMTHAAQSALRRTMEKESR------STRF 167
            :.:.:...:.:::...          :..::||:         |.|::.|::|.:      ..||
 Worm   343 IEKRREPTWKRMTGED----------YIELMLDD---------SELKKPMDEERQKRRAELEQRF 388

  Fly   168 CLICNYVSRIIVPITSRCSKFRFKALGEDKVIDRLKYIC-EMEGVKIEDDAYKSIVKISGGDLR 230
            .::.:....:                 |..:..:.|:|. |:....::.:|.|.|||....:|:
 Worm   389 AIVISKTPPV-----------------EGHIWYQGKWISEELHKKYMQFEANKEIVKNLAAELK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 39/225 (17%)
AAA 45..187 CDD:99707 23/152 (15%)
AAA_assoc_2 211..>256 CDD:292811 6/20 (30%)
Rep_fac_C <293..344 CDD:285713
mdt-30NP_498749.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.