DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8142 and hpr-17

DIOPT Version :9

Sequence 1:NP_573245.1 Gene:CG8142 / 32763 FlyBaseID:FBgn0030871 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_496793.1 Gene:hpr-17 / 174958 WormBaseID:WBGene00001998 Length:514 Species:Caenorhabditis elegans


Alignment Length:261 Identity:54/261 - (20%)
Similarity:92/261 - (35%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PRNVDDVVEQSEVVAVLRKCVE------GGDLPNMLLYGPPGTGKTST--ILAASRQIFGDMFKD 94
            ||..|::...::.:|.:...::      ...|..|.|.||.|:||::|  ::...:.|       
 Worm    15 PRRRDELQIHNKKIAEVDHWLKNVFSESNKQLGVMYLTGPAGSGKSTTVEVMCTEQNI------- 72

  Fly    95 RILE-----LNASDERGINVVRTKIKNFSQLSASSVRPDGKPCPPFKIIIL-----DEADSMTHA 149
            .|:|     |:..|........|:::.|......|:|..|..    |.::|     |:|.|....
 Worm    73 EIIEYSPEYLHNEDFECEKPDFTQLRRFLLRRHGSLRGGGLK----KRLLLVTELPDQAYSDAEK 133

  Fly   150 AQSALRRTMEKESRSTRFCLICNYVSRIIVP---------ITSRCSKFRFKALGEDKVIDRLKYI 205
            .:..|...::.......|||..:.....:.|         |.:......|..:.:..:...|...
 Worm   134 FREDLSEVLQHIWHPVIFCLTNSIACWNLNPDRLFTKDFNIMNGIDTVTFNPVADSFMKKALVRA 198

  Fly   206 CEMEGVKIEDDAYKSIVKISGGDLRRAITTLQ------SCYRLKGPEHI----INTADLFEMSGV 260
            .......:.|.....|.:.:|||||.|:..||      :..|..|...|    .|..:.|.|.|.
 Worm   199 SNCLSSPLSDAKLNVIGEEAGGDLRIAMNMLQMNSIGPNADRRSGNSVICASKANREEAFHMIGR 263

  Fly   261 I 261
            |
 Worm   264 I 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8142NP_573245.1 rfc 31..344 CDD:234763 54/261 (21%)
AAA 45..187 CDD:99707 31/168 (18%)
AAA_assoc_2 211..>256 CDD:292811 14/54 (26%)
Rep_fac_C <293..344 CDD:285713
hpr-17NP_496793.1 Rad17 15..375 CDD:251803 54/261 (21%)
AAA_16 28..153 CDD:289934 27/135 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.