DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)1 and TAFII21

DIOPT Version :9

Sequence 1:NP_523391.3 Gene:e(y)1 / 32762 FlyBaseID:FBgn0000617 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_175816.1 Gene:TAFII21 / 841854 AraportID:AT1G54140 Length:183 Species:Arabidopsis thaliana


Alignment Length:166 Identity:64/166 - (38%)
Similarity:95/166 - (57%) Gaps:7/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKTIDLDDVRLATE 82
            ||:||:::.|:||.:.|::|||||::|.||..:|||..:|.||:||:.||.|..||.|||:||.:
plant     9 VPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVEVLTDAQVYSEHASKPNIDCDDVKLAIQ 73

  Fly    83 VTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDRYCLTGVNYKLRATNQPKKMTKS 147
            ..::.||:.|..|.||.::|..||.:|||......|:.|||::..|...||:|..   |||    
plant    74 SKVNFSFSQPPPREVLLELAASRNKIPLPKSIAGPGVPLPPEQDTLLSPNYQLVI---PKK---- 131

  Fly   148 AVEGRPLKTVVKPVSSANGPKRPHSVVAKQQVVTIP 183
            :|...|.:|......:..|.........:||...:|
plant   132 SVSTEPEETEDDEEMTDPGQSSQEQQQQQQQTSDLP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)1NP_523391.3 TFIID-31kDa 16..135 CDD:280456 53/116 (46%)
TAFII21NP_175816.1 TFIID-31kDa 6..126 CDD:396739 53/116 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 110 1.000 Domainoid score I2112
eggNOG 1 0.900 - - E1_COG5094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1429345at2759
OrthoFinder 1 1.000 - - FOG0003046
OrthoInspector 1 1.000 - - oto4056
orthoMCL 1 0.900 - - OOG6_101921
Panther 1 1.100 - - LDO PTHR48068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2395
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.