DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)1 and Taf9b

DIOPT Version :9

Sequence 1:NP_523391.3 Gene:e(y)1 / 32762 FlyBaseID:FBgn0000617 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001161460.1 Gene:Taf9b / 407786 MGIID:3039562 Length:293 Species:Mus musculus


Alignment Length:189 Identity:94/189 - (49%)
Similarity:126/189 - (66%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EKSDKAKISAQIKHVPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHAR 68
            ||.:.||: |.||:.|:||.|:..|||::.:.||||||:||:|||.|||||.||||||:|::||:
Mouse    43 EKMEPAKM-APIKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAK 106

  Fly    69 KKTIDLDDVRLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDRYCLTGVNY 133
            |.|:|.||||||.:...|:|||.|..|..|..:|..:|..|||.|||:.|.||||||||||..||
Mouse   107 KPTVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNY 171

  Fly   134 KLRA-----TNQPKKMTK-SAVEGRPLKTVVKPVSSANGPKR---PHSVVAKQQVVTIP 183
            :|::     .||.:.:.: |||..||....|.|..:.:||.:   |.||.:::..|.||
Mouse   172 RLKSLVKKGPNQGRLVPRLSAVSSRPTTPPVAPPQAVSGPNKAATPVSVTSQRFAVQIP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)1NP_523391.3 TFIID-31kDa 16..135 CDD:280456 70/118 (59%)
Taf9bNP_001161460.1 TAF9 57..173 CDD:173963 69/115 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831404
Domainoid 1 1.000 157 1.000 Domainoid score I4150
eggNOG 1 0.900 - - E1_COG5094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I4086
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1429345at2759
OrthoFinder 1 1.000 - - FOG0003046
OrthoInspector 1 1.000 - - otm43125
orthoMCL 1 0.900 - - OOG6_101921
Panther 1 1.100 - - LDO PTHR48068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2308
SonicParanoid 1 1.000 - - X2395
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.