DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)1 and Taf9

DIOPT Version :9

Sequence 1:NP_523391.3 Gene:e(y)1 / 32762 FlyBaseID:FBgn0000617 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001032387.1 Gene:Taf9 / 373541 RGDID:727861 Length:264 Species:Rattus norvegicus


Alignment Length:261 Identity:101/261 - (38%)
Similarity:129/261 - (49%) Gaps:57/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQIKHVPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKTIDLDDV 77
            |..|.:|||||::..|||::.:.||||||:||:|||.|||||.||||||:|::||:|.|:|.|||
  Rat     7 ASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPTVDADDV 71

  Fly    78 RLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDRYCLTGVNYKLRA----- 137
            |||.:...|:|||.|..|..|..:|..||..|||.|||:.|.||||||||||..||:|::     
  Rat    72 RLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKA 136

  Fly   138 ---------------------------TNQPKKMTKSAVEGRPLK------TVVKPVS-----SA 164
                                       |..|:.|:.|...|.|:.      ||..|.|     .|
  Rat   137 PTPAGRITVPRLSVGSVSSRPSTPTLGTPTPQAMSVSTKVGTPMSLTGQRFTVQMPASQSPAVKA 201

  Fly   165 NGPKRPHSVVAKQQVVTIPKPVIKFTTTTTTKTVGSSGGSGGGGGQEVKSESTGAGGDLKMEVDS 229
            :.|..|    |.|.|:..|..:.......||..|          .|...:||..|....:.|.|.
  Rat   202 SIPATP----AVQNVLINPSLIGSKNILITTNMV----------SQNTANESANALKRKREEEDD 252

  Fly   230 D 230
            |
  Rat   253 D 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)1NP_523391.3 TFIID-31kDa 16..135 CDD:280456 72/118 (61%)
Taf9NP_001032387.1 TFIID-31kDa 9..129 CDD:280456 72/119 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..174 3/23 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..264 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I4066
eggNOG 1 0.900 - - E1_COG5094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4079
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1429345at2759
OrthoFinder 1 1.000 - - FOG0003046
OrthoInspector 1 1.000 - - otm45191
orthoMCL 1 0.900 - - OOG6_101921
Panther 1 1.100 - - O PTHR48068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2395
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.