DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)1 and taf9

DIOPT Version :9

Sequence 1:NP_523391.3 Gene:e(y)1 / 32762 FlyBaseID:FBgn0000617 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_592893.1 Gene:taf9 / 2543133 PomBaseID:SPAC12G12.05c Length:163 Species:Schizosaccharomyces pombe


Alignment Length:134 Identity:57/134 - (42%)
Similarity:78/134 - (58%) Gaps:5/134 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKT--IDLDDVRLAT 81
            |||.::|..||..|.|..|...|..|||.|..||...::.|::|||.|:|.:.  |.::|||||.
pombe    14 PKDVRLIHLILSSLGVPSYSQTVPLQLLTFAHRYTQQLIQDSQVYAEHSRGQNAPISVEDVRLAV 78

  Fly    82 EVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDRYCLTGVNYKL---RATNQPKK 143
            ...::.|||||..:..|.::|..||..|||.|:|..|.||||::||||..|:.:   ...||||:
pombe    79 ASQINHSFTGPPPKEFLLELAMERNRKPLPQIQPSYGFRLPPEKYCLTQPNWIVSNETQQNQPKE 143

  Fly   144 MTKS 147
            ...|
pombe   144 ENSS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)1NP_523391.3 TFIID-31kDa 16..135 CDD:280456 52/117 (44%)
taf9NP_592893.1 TAF9 1..148 CDD:227425 57/134 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I1838
eggNOG 1 0.900 - - E1_COG5094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003046
OrthoInspector 1 1.000 - - oto101036
orthoMCL 1 0.900 - - OOG6_101921
Panther 1 1.100 - - LDO PTHR48068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2308
SonicParanoid 1 1.000 - - X2395
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.