DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)1 and Taf9

DIOPT Version :9

Sequence 1:NP_523391.3 Gene:e(y)1 / 32762 FlyBaseID:FBgn0000617 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001015889.1 Gene:Taf9 / 108143 MGIID:1888697 Length:264 Species:Mus musculus


Alignment Length:208 Identity:91/208 - (43%)
Similarity:125/208 - (60%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQIKHVPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKTIDLDDV 77
            |..|.:|||||::..|||::.:.||||||:||:|||.|||||.||||||:|::||:|.|:|.|||
Mouse     7 ASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDV 71

  Fly    78 RLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDRYCLTGVNYKLRATNQP- 141
            |||.:...|:|||.|..|..|..:|..||..|||.|||:.|.||||||||||..||:|::..:. 
Mouse    72 RLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKA 136

  Fly   142 ---------KKMTKSAVEGRP-LKTVVKP------VSSANGPKRPHSVVAKQQVVTIP---KPVI 187
                     .:::..:|..|| ..|:..|      ||:..|  .|.|:..::..|.:|   .|.:
Mouse   137 PAPAGRITVPRLSVGSVSSRPSTPTLGTPTPQTMSVSTKVG--TPMSLTGQRFTVQMPASQSPAV 199

  Fly   188 K--FTTTTTTKTV 198
            |  ...|:|.:.|
Mouse   200 KASIPATSTVQNV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)1NP_523391.3 TFIID-31kDa 16..135 CDD:280456 72/118 (61%)
Taf9NP_001015889.1 TFIID-31kDa 9..130 CDD:396739 72/120 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..176 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831406
Domainoid 1 1.000 157 1.000 Domainoid score I4150
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I4086
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003046
OrthoInspector 1 1.000 - - otm43125
orthoMCL 1 0.900 - - OOG6_101921
Panther 1 1.100 - - O PTHR48068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2308
SonicParanoid 1 1.000 - - X2395
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.880

Return to query results.
Submit another query.