DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and Cacng7

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_036009491.1 Gene:Cacng7 / 81904 MGIID:1932374 Length:304 Species:Mus musculus


Alignment Length:315 Identity:61/315 - (19%)
Similarity:109/315 - (34%) Gaps:114/315 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CS--AVTL--SIATICAIIATALLAIAFSTDNWLHYD----VWRNQIQSFAAKHSDAESLLHNMN 59
            ||  |:||  |:...|.::   |:.||.|||.||:.:    :.:||.       ::.:..||   
Mouse    33 CSSRALTLLSSVFGACGLL---LVGIAVSTDYWLYMEEGTVLPQNQT-------TEVKMALH--- 84

  Fly    60 VKYYYYTRTRGLFRICYPKERPPVSAVPTYLSPIETHCSNIDYFPQAEDEKIANEDATSRLHLAR 124
                     .||:|:|:            :....:..|...:||.:.| ..:..|:..:.|...|
Mouse    85 ---------AGLWRVCF------------FAGREKGRCVASEYFLEPE-INLVTENTENILKTVR 127

  Fly   125 SCIALFIISFVTIFCAFWTG--------------LSGCWKRSSGAITATSILLLVTCLLAAGAMG 175
            :.....::|...:|.||...              :||.:...||......::|.::.:       
Mouse   128 TATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSI------- 185

  Fly   176 LWHTVEFFEKEKVV-----GEDYFQQWNTVLRDNTKIAYDWSYIVAWAGIGTCLLASILLSGA-- 233
                     .::|:     .|.||.           ..|.||:..|.:..       :|..||  
Mouse   186 ---------NDEVMNRPSSSEQYFH-----------YRYGWSFAFAASSF-------LLKEGAGV 223

  Fly   234 -AVCLRNEREKEEQLNLQYLMPVYSQKQPPYPPYANYAQPQIYPGPYYHGSQYGP 287
             :|.|..:|..||::               |.|:..:.:|::.....|.|....|
Mouse   224 MSVYLFTKRYAEEEM---------------YRPHPAFYRPRLSDCSDYSGQFLQP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 41/238 (17%)
Cacng7XP_036009491.1 PMP22_Claudin 45..224 CDD:419754 44/247 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.