DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and cacng5a

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001313491.1 Gene:cacng5a / 797409 ZFINID:ZDB-GENE-120104-4 Length:289 Species:Danio rerio


Alignment Length:310 Identity:69/310 - (22%)
Similarity:115/310 - (37%) Gaps:97/310 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CSAVTLS-IATICAIIATALLAIAFSTDNWLHYD----VWRNQIQSFAAKHSDAESLLHNMNVKY 62
            |....|: ::::.|:.:..||.||.|||.||:.:    :..||       .::....||:     
Zfish     4 CGRKVLTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGVILPLNQ-------STEIRMSLHS----- 56

  Fly    63 YYYTRTRGLFRICYPKERPPVSAV-PTYLSPIET-HCSNIDY-FPQAEDEKIANEDATSRLHLAR 124
                   ||:|:|:..|.|....| ||..|..|. .|..|:| .|.  :.::.:|...|.|.:.|
Zfish    57 -------GLWRVCFLSESPASGTVLPTGKSGDEKGRCFTIEYVMPM--NVQMTSESTASVLKMIR 112

  Fly   125 SCIALFIISFVTIFCAFWTG--------------LSGCWKRSSGAITATSILLLVTCLLAAGAMG 175
            |.....::|...:|..|...              :||.:...||......::|.::.:       
Zfish   113 SATPFPLVSLFFMFIGFVLSNIGHIRPQRTILAFISGIFFILSGLSLVVGLVLYISSI------- 170

  Fly   176 LWHTVEFFEKEKVVGEDYFQQWNTVLRDNTKIAYDWSYIVAWAGIGTCLLASILLSGAA----VC 236
               ..|...:.| ..|.||           ...|.||:  |:|.:      |.||:.||    |.
Zfish   171 ---NDEMLNRTK-TNEAYF-----------SYKYGWSF--AFAAV------SFLLTEAAGVMSVY 212

  Fly   237 LRNEREKEEQLNLQYLMPVYSQKQPPYPPYANYAQPQI-----YPGPYYH 281
            |..:|...|::               |.|:..:.:|::     |.|.:.|
Zfish   213 LFMKRYTAEEM---------------YRPHPGFYRPRLSNCSDYSGQFLH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 54/236 (23%)
cacng5aNP_001313491.1 PMP22_Claudin 8..209 CDD:304458 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.