DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and CACNG7

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001371730.1 Gene:CACNG7 / 59284 HGNCID:13626 Length:305 Species:Homo sapiens


Alignment Length:147 Identity:34/147 - (23%)
Similarity:60/147 - (40%) Gaps:43/147 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CS--AVTL--SIATICAIIATALLAIAFSTDNWLHYD----VWRNQIQSFAAKHSDAESLLHNMN 59
            ||  |:||  |:...|.::   |:.||.|||.||:.:    :.:||.       ::.:..||   
Human     4 CSSRALTLLSSVFGACGLL---LVGIAVSTDYWLYMEEGTVLPQNQT-------TEVKMALH--- 55

  Fly    60 VKYYYYTRTRGLFRICYPKERPPVSAVPTYLSPIETHCSNIDYFPQAEDEKIANEDATSRLHLAR 124
                     .||:|:|:            :....:..|...:||.:.| ..:..|:..:.|...|
Human    56 ---------AGLWRVCF------------FAGREKGRCVASEYFLEPE-INLVTENTENILKTVR 98

  Fly   125 SCIALFIISFVTIFCAF 141
            :.....::|...:|.||
Human    99 TATPFPMVSLFLVFTAF 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 27/130 (21%)
CACNG7NP_001371730.1 PMP22_Claudin 18..>143 CDD:419754 28/133 (21%)
PHA03378 <162..291 CDD:223065
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.