DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and tmem178ba

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001122218.1 Gene:tmem178ba / 569012 ZFINID:ZDB-GENE-080722-38 Length:297 Species:Danio rerio


Alignment Length:282 Identity:63/282 - (22%)
Similarity:99/282 - (35%) Gaps:95/282 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IC-AIIATALLAIAFSTDNWLHYDV--WRNQIQSFAAKHSD-----------------------A 51
            :| :::|...|.:|.|:|:|...|.  ::.:.::|:.:.||                       .
Zfish    12 LCLSLVALCFLTVAISSDHWYETDARRYKERCRTFSNRRSDPGFIYIPTHSLPLRASRASLDRWE 76

  Fly    52 ESLLHNMNVKYYY-----------YTRTR-GLFRICYPKERPPVSAVPTYLSPIET----HCSNI 100
            :.||...|.:..:           |..|. ||:..||     .|...|.....|:.    .||.|
Zfish    77 DRLLLTRNRRQLFAMSAADECSRRYNSTNMGLWSKCY-----RVGFDPDVEDLIKNGTIERCSFI 136

  Fly   101 DYFPQAED----------EKIANEDATSRLHLARSC-----IALFIISFVTIFCAFWT-GLSG-C 148
            .|:..:..          .|...:|....|||.|..     :||.||.|      .|| ||.| |
Zfish   137 KYYYSSSAVARKDLSYNITKAIQQDDWHALHLRRMTAGFMGMALSIILF------GWTIGLLGCC 195

  Fly   149 WKRS-----SGAITATS----ILLLVTCLLAAGAMGLWHTVEFFEKEKVVGEDYFQQWNTVLRDN 204
            |::.     :|.:....    |:.|.||:....          ||..:      :.::...|.|:
Zfish   196 WEQGLMHYVAGLLFLMGGTFCIISLCTCVAGIN----------FELSR------YPRYLFSLPDD 244

  Fly   205 TKIAYDWSYIVAWAGIGTCLLA 226
            ....|.||...||.|:|..|:|
Zfish   245 ISHGYGWSMFSAWGGLGLTLIA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 62/278 (22%)
tmem178baNP_001122218.1 PMP22_Claudin 104..267 CDD:304458 48/190 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.