DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and CLDND1

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001035272.1 Gene:CLDND1 / 56650 HGNCID:1322 Length:276 Species:Homo sapiens


Alignment Length:261 Identity:64/261 - (24%)
Similarity:99/261 - (37%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVTLSIATICAIIATALLAIAFSTDNWLHY-------------DVWRNQIQSFAAKHSDAESLLH 56
            |....||.:.::|:|..:|.:..||.|..|             .:|    ..|.:..:|.::   
Human    29 ATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIW----DEFISDEADEKT--- 86

  Fly    57 NMNVKYYYYTRTRGLFRIC--YPKE----RPPVSAVPTYLSPIETHCSNIDYFPQAEDEKIANED 115
             .|...:.|..|.||:|.|  .||.    .||..   |....:.|.|.:.....|..::.:...:
Human    87 -YNDALFRYNGTVGLWRRCITIPKNMHWYSPPER---TESFDVVTKCVSFTLTEQFMEKFVDPGN 147

  Fly   116 ATSRLHLARSCI--ALFIISFVTI----FCAFWTGLSGCWKRSSGAITATSILLLVTCLLAAGAM 174
            ..|.:.|.|:.:  ..|::.||::    |.|. .||..|..||.....||.||.|:..|...|::
Human   148 HNSGIDLLRTYLWRCQFLLPFVSLGLMCFGAL-IGLCACICRSLYPTIATGILHLLAGLCTLGSV 211

  Fly   175 GLWHTVEFFEKEKVVGEDYFQQWNTVLRDNTKIAYDWSYIVAWAGIGTCLLASILLSGAAVCLRN 239
            ..:          |.|.:...| ...|.||....:.||:.:|........:||.|...||...|.
Human   212 SCY----------VAGIELLHQ-KLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRK 265

  Fly   240 E 240
            |
Human   266 E 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 57/240 (24%)
CLDND1NP_001035272.1 PMP22_Claudin 40..257 CDD:389833 57/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5501
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.