DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and tmem178b

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001002396.2 Gene:tmem178b / 436669 ZFINID:ZDB-GENE-040718-92 Length:294 Species:Danio rerio


Alignment Length:299 Identity:57/299 - (19%)
Similarity:96/299 - (32%) Gaps:92/299 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TICAIIATALLAIAFSTDNWLHYDV--WRNQIQSFAAKHSD---------------AESLLHNMN 59
            ::||:   .:||:|..:|:|...|.  :|.:.:||:::..|               :.|.|....
Zfish    15 SLCAL---GMLAVAICSDHWYETDARRYRERCRSFSSRRKDPGFIYIPNNSLPLRASRSRLDRWE 76

  Fly    60 VKYYYYTRTRGLFRICYPKERPPVSAVPTYLSP---IETHCSNIDYFPQAED------------- 108
            .|.......|.||.:....|     ....|.|.   :.:.|..:.:..:.||             
Zfish    77 EKLLLARNRRQLFAMSAADE-----CSKRYNSTNMGLWSKCHRLGFDQEIEDLIRNGSIARCSYI 136

  Fly   109 -----------------EKIANEDATSRLHLARSCIALFIISFVTIFCAFWTGLSG-CWKRSSGA 155
                             .|...:|....|||.|.......::...|...:..|:.| ||.|....
Zfish   137 KYHYSSATIPKDLSYNITKTIRQDEWHSLHLRRMTAGFMGMAVAIILFGWIIGMLGCCWDRGLMQ 201

  Fly   156 ITATSILL---------LVTCLLAAGAMGLWHTVEFFEKEKVVGEDYFQQWNTVLRDNTKIAYDW 211
            ..|..:.|         |.||:....          ||..:      :.::...|.|:....|.|
Zfish   202 YVAGLLFLMGGTFCIISLCTCVAGIN----------FELSR------YPRYIYGLPDDISHGYGW 250

  Fly   212 SYIVAWAGIGTCLLASILLSGA--------AVCLRNERE 242
            |...||.|:|..|:|....:.|        :.|.::.:|
Zfish   251 SMFCAWGGLGLSLIAGFFCTLAPSVQPIPRSTCPKSRQE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 52/275 (19%)
tmem178bNP_001002396.2 PMP22_Claudin 104..266 CDD:304458 32/177 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.