DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and tmem178.2

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001001190.1 Gene:tmem178.2 / 407851 XenbaseID:XB-GENE-5809007 Length:314 Species:Xenopus tropicalis


Alignment Length:335 Identity:76/335 - (22%)
Similarity:107/335 - (31%) Gaps:127/335 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSIATIC-AIIATALLAIAFSTDNWLHYDV--WRNQIQSFAAKHSDAESLLHNMNVKYYYYTRTR 69
            |:.|.:| |:.|.||||:|.|||:|...|.  .|::.:....|.:|..          |.||..:
 Frog     4 LAGAGLCLALAALALLAVALSTDHWYETDARRHRDRCRKPGGKRNDPG----------YMYTPGQ 58

  Fly    70 GL--------FRICYP----------------------KERP------PVSAVPTYLSPIETHCS 98
            .|        .||..|                      :|||      |:|.  .||: .:.|||
 Frog    59 HLPLRGEPPSSRIRSPRGGEPGGVRMISRAEDLGVRGLRERPTGARDLPLSR--PYLA-TDPHCS 120

  Fly    99 --------------NIDYFPQAEDE-------------------------------KIANEDATS 118
                          :.|.|.:..:|                               |...:|...
 Frog   121 RRFNSTVSGLWRKCHRDGFDKDTEELILKGIVERCTSVRYYYTSSSLPPNLSVNVTKTIRQDEWH 185

  Fly   119 RLHLARSCIALFIISFVTIFCAFW-TGLSGCWKRSSGAITATSILLLV--------TCLLAAGAM 174
            .||| |...|.||...|:|....| .|:.||.|:.........:|.|:        .|...||..
 Frog   186 ALHL-RRMTAGFIGMAVSIILFGWMVGVLGCCKQHDLMQYVAGLLFLMGGTCCIISLCTCVAGIN 249

  Fly   175 GLWHTVEFFEKEKVVGEDYFQQWNTVLRDNTKIAYDWSYIVAWAGIGTCLLASIL------LSGA 233
                    ||..:.....|      .|.:.....|.||...||.|:|..||:..|      ||.:
 Frog   250 --------FELSRYPRSIY------SLPEEISHGYGWSMFCAWGGLGLTLLSGFLCTLAPSLSAS 300

  Fly   234 AVCLRNEREK 243
            ...:...|::
 Frog   301 QSAVHKPRQE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 70/313 (22%)
tmem178.2NP_001001190.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..83 11/60 (18%)
PMP22_Claudin 128..278 CDD:389833 31/164 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.