DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and Tmem178a

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001004282.1 Gene:Tmem178a / 362691 RGDID:1303057 Length:297 Species:Rattus norvegicus


Alignment Length:305 Identity:59/305 - (19%)
Similarity:101/305 - (33%) Gaps:107/305 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SAVTLSIATICAIIATALLAIAFSTDNWLHYDVWRNQIQSFAAK--------------------- 47
            :|::|.: ::|::   .||..|..||:|...|..|::.....::                     
  Rat     8 TALSLGL-SLCSL---GLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLR 68

  Fly    48 ---------------HSDAESL-----LHNMNVK-----YYYYTRTRGLFRICY--PKERPPVSA 85
                           .||.||.     |..::.:     :..|:   ||:|.||  ..:|...:.
  Rat    69 DSPPLGRRLLPGGPGRSDPESWRSLLGLGGLDAECGRPLFATYS---GLWRKCYFLGIDRDIDTL 130

  Fly    86 VPTYLSPIETHCSNIDY-FPQA--------EDEKIANEDATSRLHLARSCIALFIISFVTIFCAF 141
            :   |..|...|:.:.| |.|.        ...||..:|....|||.|.......::...:.|  
  Rat   131 I---LKGIAQRCTAVKYHFSQPIRLRNIPFNLTKIIQQDEWHLLHLRRITAGFLGMAVAVLLC-- 190

  Fly   142 WTGLSGC--------WKRSSGAITATSILLLVTCLLAAGAMGLWHTVEFFEKEKVVGEDYFQQWN 198
                 ||        |:.|.....| .:|.|:|        |::.|:........|..|.    |
  Rat   191 -----GCIVATVSFFWEESLTQHVA-GLLFLMT--------GIFCTISLCTYAASVSYDL----N 237

  Fly   199 TV------LRDNTKIAYDWSYIVAWAGIGTCLLASILLSGAAVCL 237
            .|      |..:.:..|.||...||..:|      .:::...:|:
  Rat   238 RVPKLIYSLPHDVEHGYSWSIFCAWCSLG------FIVAAGGLCI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 55/286 (19%)
Tmem178aNP_001004282.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..86 0/44 (0%)
PMP22_Claudin 106..274 CDD:419754 42/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.