DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and Cacng5

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001186230.1 Gene:Cacng5 / 140723 MGIID:2157946 Length:275 Species:Mus musculus


Alignment Length:301 Identity:67/301 - (22%)
Similarity:113/301 - (37%) Gaps:99/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVTLSIATICAIIATALLAIAFSTDNWLHYD--VWRNQIQSFAAKHSDAESLLHNMNVKYYYYTR 67
            |:|| ::::.|:....||.||.|||.||:.:  :...|.||...|.|     ||:          
Mouse     8 ALTL-LSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMS-----LHS---------- 56

  Fly    68 TRGLFRICY--PKERPPVSAVPTYLSPIETHCSNIDY-FPQAEDEKIANEDATSRLHLARSCIAL 129
              ||:|:|:  .:||              ..|..|:| .|.  :.::.:|...:.|.:.||....
Mouse    57 --GLWRVCFLAGEER--------------GRCFTIEYVMPM--NSQMTSESTVNVLKMIRSATPF 103

  Fly   130 FIISFVTIFCAFWTG--------------LSGCWKRSSGAITATSILLLVTCLLAAGAMGLWHTV 180
            .::|...:|..|...              :||.:...||......::|.::.:          ..
Mouse   104 PLVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSI----------ND 158

  Fly   181 EFFEKEKVVGEDYFQQWNTVLRDNTKIAYDWSYIVAWAGIGTCLLASILLSGAAVCLRNEREKEE 245
            |...:.| ..|.||         |.|  |.||:  |:|.|      |.||:          |...
Mouse   159 EMLNRTK-DAETYF---------NYK--YGWSF--AFAAI------SFLLT----------ESAG 193

  Fly   246 QLNLQYLMPVYSQKQPPYPPYANYAQPQI-----YPGPYYH 281
            .:::...|..|: .:..|.|:..:.:|::     |.|.:.|
Mouse   194 VMSVYLFMKRYT-AEDMYRPHPGFYRPRLSNCSDYSGQFLH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 54/234 (23%)
Cacng5NP_001186230.1 PMP22_Claudin 18..195 CDD:389833 55/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.