DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and TMEM178B

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001182207.1 Gene:TMEM178B / 100507421 HGNCID:44112 Length:294 Species:Homo sapiens


Alignment Length:275 Identity:57/275 - (20%)
Similarity:92/275 - (33%) Gaps:77/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSIATICAIIATALLAIAFSTDNWLHYDV--WRNQIQSFAAKHSDAESLLHNMN----------- 59
            ||:| :||:   .:||:|..:|:|...|.  .|::.::|..:..|...:.:|.|           
Human    12 LSLA-LCAL---GMLAVAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRSRL 72

  Fly    60 ------------------------VKYYYYTRTRGLFRICYPKERPPVSAVPTYLSPIETHCSNI 100
                                    ....|.:...||:|.|:.:...|..|.......|| .|:.|
Human    73 DRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIE-RCTYI 136

  Fly   101 DYFPQAED---------EKIANEDATSRLHLARSCIALFIISFVTIFCAFWTGLSG-CWKRSSGA 155
            .|...:..         .|...:|....|||.|.......::...|...:..|:.| ||.|....
Human   137 KYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMTAGFMGMAVAIILFGWIIGVLGCCWDRGLMQ 201

  Fly   156 ITATSILL---------LVTCLLAAGAMGLWHTVEFFEKEKVVGEDYFQQWNTVLRDNTKIAYDW 211
            ..|..:.|         |.||:....          ||..:      :.::...|.|:....|.|
Human   202 YVAGLLFLMGGTFCIISLCTCVAGIN----------FELSR------YPRYLYGLPDDISHGYGW 250

  Fly   212 SYIVAWAGIGTCLLA 226
            |...||.|:|..|::
Human   251 SMFCAWGGLGLTLIS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 52/267 (19%)
TMEM178BNP_001182207.1 PMP22_Claudin 100..266 CDD:389833 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.