DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6398 and tmem178a

DIOPT Version :9

Sequence 1:NP_001285391.1 Gene:CG6398 / 32761 FlyBaseID:FBgn0030870 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_002933912.1 Gene:tmem178a / 100488502 XenbaseID:XB-GENE-942687 Length:304 Species:Xenopus tropicalis


Alignment Length:300 Identity:56/300 - (18%)
Similarity:96/300 - (32%) Gaps:100/300 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SAVTLSIATICAIIATALLAIAFSTDNWLHYDVWRNQIQSFAAKHSD------------------ 50
            :|::|:: :||:::   ||..|..||:|.|.|..:::....:..:||                  
 Frog     8 TAISLTL-SICSLL---LLVTAIFTDHWYHTDTRKHKEMCDSQGNSDPTDQKNRLMPLYQLPFRG 68

  Fly    51 ---------------------AESLLHN-----------MNVKYYYYTRTRGLFRICYPKERPPV 83
                                 .|.||.|           .:.....::...||:|.||      :
 Frog    69 DPSKTRRLGLLSPAPAGGVREPEDLLENWRSLLGLGVLESDCGRPLFSTYSGLWRKCY------I 127

  Fly    84 SAVP-----TYLSPIETHCSNIDY-FPQA--------EDEKIANEDATSRLHLARSCIALFIISF 134
            ..:.     ..:..|...|:.|.| |.|.        ...:...:|....|||.|.......::.
 Frog   128 MGIDKDIDNLIMKGIAQKCTAIKYHFSQPIRLRNIPFNLTRAIQQDEWHLLHLRRITAGFLGMAA 192

  Fly   135 VTIFCAFWTGLSGC--------WKRSSGAITATSILLLVTCLLAAGAMGLWHTVEFFEKEKVVGE 191
            ..:.|       ||        |:.|.....| .:|.|:|        |::.|:........|..
 Frog   193 AVLLC-------GCIVAAISFFWEESLTQHVA-GLLFLMT--------GIFCTISLCTYAASVAY 241

  Fly   192 DY--FQQWNTVLRDNTKIAYDWSYIVAWAGIGTCLLASIL 229
            |.  ..::...|..:.:..|.||...||..:|..:.|..|
 Frog   242 DLNRLPKFIYGLPSDVEHGYSWSLFCAWCSLGLIVAAGCL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6398NP_001285391.1 Claudin_2 16..232 CDD:290614 51/287 (18%)
tmem178aXP_002933912.1 PMP22_Claudin 117..281 CDD:389833 37/185 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.