DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and SOCS1

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_003736.1 Gene:SOCS1 / 8651 HGNCID:19383 Length:211 Species:Homo sapiens


Alignment Length:150 Identity:50/150 - (33%)
Similarity:74/150 - (49%) Gaps:23/150 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   849 GWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSF-GSYA 912
            |:||||||...|.:.|.:||.|:|:||||...:..|:||.|:.:....:|:....|.|.. ||..
Human    78 GFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRE 142

  Fly   913 KFKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAV 977
            .|  ..:.|.:|..|.                 .|.|: |..|: |.:.|:.||.:||..|:..|
Human   143 SF--DCLFELLEHYVA-----------------APRRM-LGAP
L-RQRRVRPLQELCRQRIVATV 186

  Fly   978 IRKDLIQTLPLPRRLLDYLN 997
            .|::|.: :||...|.|||:
Human   187 GRENLAR-IPLNPVLRDYLS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 30/88 (34%)
SOCS_SOCS7 960..1009 CDD:239710 15/37 (41%)
SOCS1NP_003736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
Kinase inhibitory region (KIR) 55..66
Extended SH2 subdomain (ESS) 67..78 50/149 (34%)
SH2_SOCS1 68..165 CDD:198245 33/106 (31%)
SOCS_SOCS1 169..211 CDD:239704 15/37 (41%)
Interaction with Elongin BC complex. /evidence=ECO:0000250 173..182 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.