DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and SLA2

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_016883587.1 Gene:SLA2 / 84174 HGNCID:17329 Length:288 Species:Homo sapiens


Alignment Length:196 Identity:47/196 - (23%)
Similarity:74/196 - (37%) Gaps:61/196 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 PLPKKALPFTAAAYAIEA---VKSEPEEVKTNAIQ-----------------EP----------- 833
            |..:|:||..:.:.:::.   |..|.|..|..|:.                 ||           
Human     5 PSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWW 69

  Fly   834 --------RALQFTS-SIEKVKDYGWYWGPLSSEAAEK--VLSSEPDGSFIVRDSSDDHYIFSLS 887
                    |.....| .:.|| .:||.:..||.|.||:  :|...|.|:|::|:|......:|||
Human    70 TVLSEVSGREYNIPSVHVAKV-SHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLS 133

  Fly   888 FKLN-----NCVRHVRIE-QDQGTFSFGSYAKFKSQTITEFIEKAVEH----SRSGRYLFFLHRR 942
            .:|:     :.:||.||. .|.|.........|.|      ::..|:|    .:||  |.:.|..
Human   134 VRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPS------LQALVDHYSDRQKSG--LPYFHAS 190

  Fly   943 P 943
            |
Human   191 P 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 32/110 (29%)
SOCS_SOCS7 960..1009 CDD:239710
SLA2XP_016883587.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.