DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Socs16D and Cish

DIOPT Version :9

Sequence 1:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_113992.1 Gene:Cish / 83681 RGDID:69261 Length:257 Species:Rattus norvegicus


Alignment Length:240 Identity:62/240 - (25%)
Similarity:96/240 - (40%) Gaps:62/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   797 ALPPLPKKALPFTAAAYAIEAVKSEPEEVKTNAIQEPRALQ-------FTSSIEKVKDYGWYWGP 854
            |:.|||..|.|           :...||....:..||:.|.       ...:...:::.|||||.
  Rat    33 AMQPLPTGAFP-----------EEVTEETPVQSENEPKVLDPEGDLLCIAKTFSYLRESGWYWGS 86

  Fly   855 LSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQ-- 917
            :::..|.:.|...|:|:|:||||:...|:|:||.|......:||||....:|...|....:.:  
  Rat    87 ITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRIL 151

  Fly   918 -------TITEFIEKAVEHSRSGRYLFFLHRRPEHGP------------------------MRVQ 951
                   .:..::......:||.        .|:..|                        :.::
  Rat   152 AFPDVVSLVQHYVASCTADTRSD--------SPDPAPTPALPVPKPDAPGDPVLPIPVATAVHLK 208

  Fly   952 LTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYL 996
            |..|..|....:||||:||.||.:.|...|   .||||||:.|||
  Rat   209 LVQPFVRRSSARSLQHLCRLVINRLVTDVD---CLPLPRRMADYL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 27/106 (25%)
SOCS_SOCS7 960..1009 CDD:239710 19/37 (51%)
CishNP_113992.1 SH2_CIS 77..164 CDD:198285 25/86 (29%)
SOCS_CIS1 217..257 CDD:239703 19/37 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.